PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C007417P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 357aa    MW: 39791.6 Da    PI: 6.0994
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C007417P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-092843182155
                     HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                     k +yps++++  LA+++gL+++q+ +WF N+R ++
  MELO3C007417P1 284 KWPYPSESQKLALAQSTGLDQKQINNWFINQRKRH 318
                     569*****************************885 PP

2ELK41.13.6e-14238259122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK qLlrKYsgyLgsLkqEF+
  MELO3C007417P1 238 ELKGQLLRKYSGYLGSLKQEFM 259
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-1898142IPR005540KNOX1
PfamPF037909.1E-22100138IPR005540KNOX1
SMARTSM012565.7E-24149200IPR005541KNOX2
PfamPF037914.5E-20152198IPR005541KNOX2
PROSITE profilePS5121311.174238258IPR005539ELK domain
SMARTSM011882.8E-8238259IPR005539ELK domain
PfamPF037895.9E-11238259IPR005539ELK domain
PROSITE profilePS5007113.005258321IPR001356Homeobox domain
SuperFamilySSF466891.92E-19260334IPR009057Homeodomain-like
SMARTSM003897.7E-13260325IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.0E-28263323IPR009057Homeodomain-like
CDDcd000861.26E-12270322No hitNo description
PfamPF059206.4E-17278317IPR008422Homeobox KN domain
PROSITE patternPS000270296319IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MDGPSGNCSG GMMNFGDQNN NNNNNNNGLC SMMMMMPLIS ASQQGGDGSS CTPFLPLPPP  60
NYNNTNNNNN SICNYFMDET NNNNNNNSES SNGANSCCEV KAKIMAHPHY HRLLTAYVNC  120
RKVGAPPEVV ARLEEACASA VTMSSGNNGG GCIGEDPALD QFMEAYCEML TKYEQELSKP  180
FRDAMLFLQR IDSQFKALSI SSSHLPPACG EAFDRNGSSE EEVDINGHSI DPQAEDRELK  240
GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWS RHYKWPYPSE SQKLALAQST  300
GLDQKQINNW FINQRKRHWK PSEDMQFVVM DAAHPQYYMD AVLGNPFPLD ISPALL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1253262LKQEFMKKRK
2259263KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008440041.10.0PREDICTED: homeobox protein knotted-1-like LET6
SwissprotP466081e-146HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0A0KJU40.0A0A0A0KJU4_CUCSA; Uncharacterized protein
STRINGVIT_12s0059g01190.t011e-157(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-135KNOX/ELK homeobox transcription factor